Lineage for d2jdra_ (2jdr A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2544545Protein Pkb kinase (Akt-2) [82791] (1 species)
    AGC group; RAC/Akt subfamily; serine/threonine kinase
  7. 2544546Species Human (Homo sapiens) [TaxId:9606] [82792] (16 PDB entries)
  8. 2544551Domain d2jdra_: 2jdr A: [138276]
    automated match to d1o6la_
    complexed with l20

Details for d2jdra_

PDB Entry: 2jdr (more details), 2.3 Å

PDB Description: structure of pkb-beta (akt2) complexed with the inhibitor a-443654
PDB Compounds: (A:) rac-beta serine/threonine-protein kinase

SCOPe Domain Sequences for d2jdra_:

Sequence, based on SEQRES records: (download)

>d2jdra_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]}
kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
qsititppdrydslglleldqreeqemfedfdyiadw

Sequence, based on observed residues (ATOM records): (download)

>d2jdra_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]}
kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
qsitqemfedfdyiadw

SCOPe Domain Coordinates for d2jdra_:

Click to download the PDB-style file with coordinates for d2jdra_.
(The format of our PDB-style files is described here.)

Timeline for d2jdra_: