Lineage for d2jdie1 (2jdi E:358-474)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 643803Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 643804Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 643805Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 643851Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species)
  7. 643891Species Rat (Rattus norvegicus) [TaxId:10116] [88930] (4 PDB entries)
  8. 643893Domain d2jdie1: 2jdi E:358-474 [138266]
    Other proteins in same PDB: d2jdid2, d2jdid3, d2jdie2, d2jdie3, d2jdif2, d2jdif3, d2jdig1, d2jdih1, d2jdih2
    automatically matched to d1mabb1
    complexed with anp, mg

Details for d2jdie1

PDB Entry: 2jdi (more details), 1.9 Å

PDB Description: ground state structure of f1-atpase from bovine heart mitochondria (bovine f1-atpase crystallised in the absence of azide)
PDB Compounds: (E:) ATP synthase subunit beta

SCOP Domain Sequences for d2jdie1:

Sequence, based on SEQRES records: (download)

>d2jdie1 a.69.1.1 (E:358-474) F1 ATP synthase beta subunit, domain 3 {Rat (Rattus norvegicus) [TaxId: 10116]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

Sequence, based on observed residues (ATOM records): (download)

>d2jdie1 a.69.1.1 (E:358-474) F1 ATP synthase beta subunit, domain 3 {Rat (Rattus norvegicus) [TaxId: 10116]}
mdpnivgsehydvargvqkilqdykslqdilseedkltvsrarkiqrflsqpfqvaevft
ghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

SCOP Domain Coordinates for d2jdie1:

Click to download the PDB-style file with coordinates for d2jdie1.
(The format of our PDB-style files is described here.)

Timeline for d2jdie1: