Class b: All beta proteins [48724] (165 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) |
Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [88679] (4 PDB entries) |
Domain d2jdid2: 2jdi D:10-81 [138264] Other proteins in same PDB: d2jdid1, d2jdid3, d2jdie1, d2jdie3, d2jdif1, d2jdif3, d2jdig1, d2jdih1, d2jdih2 automatically matched to d1mabb2 complexed with anp, mg |
PDB Entry: 2jdi (more details), 1.9 Å
SCOP Domain Sequences for d2jdid2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jdid2 b.49.1.1 (D:10-81) F1 ATP synthase beta subunit, domain 1 {Rat (Rattus norvegicus) [TaxId: 10116]} tgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgtegl vrgqkvldsgap
Timeline for d2jdid2: