Lineage for d2jdid2 (2jdi D:10-81)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 671687Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 671688Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 671689Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 671735Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species)
  7. 671775Species Rat (Rattus norvegicus) [TaxId:10116] [88679] (4 PDB entries)
  8. 671776Domain d2jdid2: 2jdi D:10-81 [138264]
    Other proteins in same PDB: d2jdid1, d2jdid3, d2jdie1, d2jdie3, d2jdif1, d2jdif3, d2jdig1, d2jdih1, d2jdih2
    automatically matched to d1mabb2
    complexed with anp, mg

Details for d2jdid2

PDB Entry: 2jdi (more details), 1.9 Å

PDB Description: ground state structure of f1-atpase from bovine heart mitochondria (bovine f1-atpase crystallised in the absence of azide)
PDB Compounds: (D:) ATP synthase subunit beta

SCOP Domain Sequences for d2jdid2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jdid2 b.49.1.1 (D:10-81) F1 ATP synthase beta subunit, domain 1 {Rat (Rattus norvegicus) [TaxId: 10116]}
tgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgtegl
vrgqkvldsgap

SCOP Domain Coordinates for d2jdid2:

Click to download the PDB-style file with coordinates for d2jdid2.
(The format of our PDB-style files is described here.)

Timeline for d2jdid2: