Lineage for d2jclb1 (2jcl B:2082-2358)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2505843Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2505844Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2506312Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins)
    automatically mapped to Pfam PF03414
  6. 2506313Protein alpha-1,3-galactosyltransferase catalytic domain [64132] (1 species)
  7. 2506314Species Cow (Bos taurus) [TaxId:9913] [64133] (28 PDB entries)
    Uniprot P14769
  8. 2506364Domain d2jclb1: 2jcl B:2082-2358 [138261]
    automatically matched to d1g8oa_
    complexed with so4

Details for d2jclb1

PDB Entry: 2jcl (more details), 3.29 Å

PDB Description: crystal structure of alpha-1,3 galactosyltransferase (r365k) in the absence of ligands
PDB Compounds: (B:) n-acetyllactosaminide alpha-1,3-galactosyltransferase

SCOPe Domain Sequences for d2jclb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jclb1 c.68.1.9 (B:2082-2358) alpha-1,3-galactosyltransferase catalytic domain {Cow (Bos taurus) [TaxId: 9913]}
klklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryie
hyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdismm
rmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndftye
rrkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqwhdeshln
kyfllnkptkilspeycwdyhiglpadiklvkmswqt

SCOPe Domain Coordinates for d2jclb1:

Click to download the PDB-style file with coordinates for d2jclb1.
(The format of our PDB-style files is described here.)

Timeline for d2jclb1: