SCOPe 2.08: Domain d2jcla1: 2jcl A:1082-1358

Lineage for d2jcla1 (2jcl A:1082-1358)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins)
   automatically mapped to Pfam PF03414

6. Protein alpha-1,3-galactosyltransferase catalytic domain [64132] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [64133] (28 PDB entries)
   Uniprot P14769

8. Domain d2jcla1: 2jcl A:1082-1358 [138260]
   automatically matched to d1g8oa_
   complexed with so4

Details for d2jcla1

PDB Entry: 2jcl, 3.29 Å

PDB Description: crystal structure of alpha-1,3 galactosyltransferase (r365k) in the absence of ligands

PDB Compounds: (A:) n-acetyllactosaminide alpha-1,3-galactosyltransferase

SCOPe Domain Sequences for d2jcla1:

Sequence; same for both SEQRES and ATOM records:

>d2jcla1 c.68.1.9 (A:1082-1358) alpha-1,3-galactosyltransferase catalytic domain {Cow (Bos taurus) [TaxId: 9913]}
klklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryie
hyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdismm
rmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndftye
rrkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqwhdeshln
kyfllnkptkilspeycwdyhiglpadiklvkmswqt

Timeline for d2jcla1:

• d2jcla1 first appeared in SCOP 1.73
  
• d2jcla1 appears in SCOPe 2.07