Lineage for d2jcja1 (2jcj A:82-358)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 841352Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 841353Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (19 families) (S)
  5. 841590Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (3 proteins)
  6. 841591Protein alpha-1,3-galactosyltransferase catalytic domain [64132] (1 species)
  7. 841592Species Cow (Bos taurus) [TaxId:9913] [64133] (19 PDB entries)
    Uniprot P14769
  8. 841614Domain d2jcja1: 2jcj A:82-358 [138258]
    automatically matched to d1g8oa_
    complexed with gol, mn, mpd, trs, udp; mutant

Details for d2jcja1

PDB Entry: 2jcj (more details), 2.02 Å

PDB Description: crystal structure of alpha-1,3 galactosyltransferase (c-terminus truncated mutant-c3) in complex with udp and tris
PDB Compounds: (A:) n-acetyllactosaminide alpha-1,3-galactosyltransferase

SCOP Domain Sequences for d2jcja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jcja1 c.68.1.9 (A:82-358) alpha-1,3-galactosyltransferase catalytic domain {Cow (Bos taurus) [TaxId: 9913]}
klklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryie
hyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdismm
rmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndftye
rrkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqwhdeshln
kyfllnkptkilspeycwdyhiglpadiklvkmswqt

SCOP Domain Coordinates for d2jcja1:

Click to download the PDB-style file with coordinates for d2jcja1.
(The format of our PDB-style files is described here.)

Timeline for d2jcja1: