SCOP 1.73: Domain d2jcja1: 2jcj A:82-358

Lineage for d2jcja1 (2jcj A:82-358)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (15 families)

5. Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (3 proteins)

6. Protein alpha-1,3-galactosyltransferase catalytic domain [64132] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [64133] (18 PDB entries)

8. Domain d2jcja1: 2jcj A:82-358 [138258]
   automatically matched to d1g8oa_
   complexed with gol, mn, mpd, trs, udp; mutant

Details for d2jcja1

PDB Entry: 2jcj, 2.02 Å

PDB Description: crystal structure of alpha-1,3 galactosyltransferase (c-terminus truncated mutant-c3) in complex with udp and tris

PDB Compounds: (A:) n-acetyllactosaminide alpha-1,3-galactosyltransferase

SCOP Domain Sequences for d2jcja1:

Sequence; same for both SEQRES and ATOM records:

>d2jcja1 c.68.1.9 (A:82-358) alpha-1,3-galactosyltransferase catalytic domain {Cow (Bos taurus) [TaxId: 9913]}
klklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryie
hyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdismm
rmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndftye
rrkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqwhdeshln
kyfllnkptkilspeycwdyhiglpadiklvkmswqt

Timeline for d2jcja1:

• d2jcja1 is new in SCOP 1.73
  
• d2jcja1 appears in SCOP 1.75
  
• d2jcja1 appears in the current release, SCOPe 2.08, called d2jcja_