Lineage for d2jbja2 (2jbj A:118-350)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 689773Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 689891Superfamily c.8.4: PA domain [52025] (1 family) (S)
  5. 689892Family c.8.4.1: PA domain [52026] (2 proteins)
  6. 689893Protein Glutamate carboxypeptidase II [141984] (1 species)
  7. 689894Species Human (Homo sapiens) [TaxId:9606] [141985] (11 PDB entries)
  8. 689901Domain d2jbja2: 2jbj A:118-350 [138251]
    Other proteins in same PDB: d2jbja1, d2jbja3
    automatically matched to 2C6C A:118-350
    complexed with bma, ca, cl, g88, man, nag, zn

Details for d2jbja2

PDB Entry: 2jbj (more details), 2.19 Å

PDB Description: membrane-bound glutamate carboxypeptidase ii (gcpii) in complex with 2-pmpa (2-phosphonomethyl-pentanedioic acid)
PDB Compounds: (A:) glutamate carboxypeptidase 2

SCOP Domain Sequences for d2jbja2:

Sequence, based on SEQRES records: (download)

>d2jbja2 c.8.4.1 (A:118-350) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
sypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdlvyv
nyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpadyfap
gvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipvhpi
gyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvkmhihstn

Sequence, based on observed residues (ATOM records): (download)

>d2jbja2 c.8.4.1 (A:118-350) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
sypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdlvyv
nyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpadyfap
gvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipvhpi
gyydaqkllekmggsappdsswrgslkvpynvgpgftfstqkvkmhihstn

SCOP Domain Coordinates for d2jbja2:

Click to download the PDB-style file with coordinates for d2jbja2.
(The format of our PDB-style files is described here.)

Timeline for d2jbja2: