SCOP 1.75: Domain d2jbga1: 2jbg A:2-87

Lineage for d2jbga1 (2jbg A:2-87)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family)

5. Family a.28.2.1: Colicin E immunity proteins [47346] (3 proteins)

6. Protein ImmE7 protein (Im7) [47347] (1 species)

7. Species Escherichia coli [TaxId:562] [47348] (10 PDB entries)

8. Domain d2jbga1: 2jbg A:2-87 [138248]
   Other proteins in same PDB: d2jbgb1, d2jbgd1
   automatically matched to d1mz8a_
   complexed with so4, zn; mutant

Details for d2jbga1

PDB Entry: 2jbg, 2.2 Å

PDB Description: crystal structure of the mutant n560a of the nuclease domain of cole7 in complex with im7

PDB Compounds: (A:) colicin-e7 immunity protein

SCOP Domain Sequences for d2jbga1:

Sequence; same for both SEQRES and ATOM records:

>d2jbga1 a.28.2.1 (A:2-87) ImmE7 protein (Im7) {Escherichia coli [TaxId: 562]}
elknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdnr
ddspegivkeikewraangkpgfkqg

Timeline for d2jbga1:

• d2jbga1 first appeared in SCOP 1.73
  
• d2jbga1 is called d2jbga_ in SCOPe 2.01
  
• d2jbga1 appears in the current release, SCOPe 2.08, called d2jbga_