![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures |
![]() | Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families) ![]() common motif contains conserved histidine residue and metal-binding site |
![]() | Family d.4.1.1: HNH-motif [54061] (2 proteins) |
![]() | Protein DNase domain of colicin E7 [54062] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [54063] (6 PDB entries) |
![]() | Domain d2jb0b1: 2jb0 B:449-572 [138247] Other proteins in same PDB: d2jb0a1 automatically matched to d1m08a_ complexed with zn; mutant |
PDB Entry: 2jb0 (more details), 1.91 Å
SCOP Domain Sequences for d2jb0b1:
Sequence, based on SEQRES records: (download)
>d2jb0b1 d.4.1.1 (B:449-572) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]} kpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpe lskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvvtpkr hidi
>d2jb0b1 d.4.1.1 (B:449-572) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]} kpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpe lskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisggvydmdnisvvtpkrhi di
Timeline for d2jb0b1: