Lineage for d2jb0b1 (2jb0 B:449-572)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 715661Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 715662Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 715663Family d.4.1.1: HNH-motif [54061] (2 proteins)
  6. 715664Protein DNase domain of colicin E7 [54062] (1 species)
  7. 715665Species Escherichia coli [TaxId:562] [54063] (6 PDB entries)
  8. 715666Domain d2jb0b1: 2jb0 B:449-572 [138247]
    Other proteins in same PDB: d2jb0a1
    automatically matched to d1m08a_
    complexed with zn; mutant

Details for d2jb0b1

PDB Entry: 2jb0 (more details), 1.91 Å

PDB Description: crystal structure of the mutant h573a of the nuclease domain of cole7 in complex with im7
PDB Compounds: (B:) colicin e7

SCOP Domain Sequences for d2jb0b1:

Sequence, based on SEQRES records: (download)

>d2jb0b1 d.4.1.1 (B:449-572) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]}
kpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpe
lskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvvtpkr
hidi

Sequence, based on observed residues (ATOM records): (download)

>d2jb0b1 d.4.1.1 (B:449-572) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]}
kpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpe
lskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisggvydmdnisvvtpkrhi
di

SCOP Domain Coordinates for d2jb0b1:

Click to download the PDB-style file with coordinates for d2jb0b1.
(The format of our PDB-style files is described here.)

Timeline for d2jb0b1: