SCOPe 2.08: Domain d2jb0b_: 2jb0 B:

Lineage for d2jb0b_ (2jb0 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.1: HNH-motif [54061] (3 proteins)

6. Protein DNase domain of colicin E7 [54062] (1 species)

7. Species Escherichia coli [TaxId:562] [54063] (10 PDB entries)

8. Domain d2jb0b_: 2jb0 B: [138247]
   Other proteins in same PDB: d2jb0a_
   automated match to d1mz8b_
   protein/DNA complex; complexed with zn; mutant

Details for d2jb0b_

PDB Entry: 2jb0, 1.91 Å

PDB Description: crystal structure of the mutant h573a of the nuclease domain of cole7 in complex with im7

PDB Compounds: (B:) colicin e7

SCOPe Domain Sequences for d2jb0b_:

Sequence, based on SEQRES records:

>d2jb0b_ d.4.1.1 (B:) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]}
kpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpe
lskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisqnggvydmdnisvvtpkr
hidi

Sequence, based on observed residues (ATOM records):

>d2jb0b_ d.4.1.1 (B:) DNase domain of colicin E7 {Escherichia coli [TaxId: 562]}
kpgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpe
lskqfsrnnndrmkvgkapktrtqdvsgkrtsfelhhekpisggvydmdnisvvtpkrhi
di

Timeline for d2jb0b_:

• d2jb0b_ first appeared in SCOP 1.73, called d2jb0b1
  
• d2jb0b_ appears in SCOPe 2.07