![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families) ![]() automatically mapped to Pfam PF01320 |
![]() | Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins) |
![]() | Protein ImmE7 protein (Im7) [47347] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [47348] (10 PDB entries) |
![]() | Domain d2jb0a_: 2jb0 A: [138246] Other proteins in same PDB: d2jb0b_ automated match to d1mz8a_ protein/DNA complex; complexed with zn; mutant |
PDB Entry: 2jb0 (more details), 1.91 Å
SCOPe Domain Sequences for d2jb0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jb0a_ a.28.2.1 (A:) ImmE7 protein (Im7) {Escherichia coli [TaxId: 562]} lknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdnrd dspegivkeikewraangkpgfkqg
Timeline for d2jb0a_: