SCOPe 2.06: Domain d2jb0a_: 2jb0 A:

Lineage for d2jb0a_ (2jb0 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families)
   automatically mapped to Pfam PF01320

5. Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins)

6. Protein ImmE7 protein (Im7) [47347] (1 species)

7. Species Escherichia coli [TaxId:562] [47348] (10 PDB entries)

8. Domain d2jb0a_: 2jb0 A: [138246]
   Other proteins in same PDB: d2jb0b_
   automated match to d1mz8a_
   protein/DNA complex; complexed with zn; mutant

Details for d2jb0a_

PDB Entry: 2jb0, 1.91 Å

PDB Description: crystal structure of the mutant h573a of the nuclease domain of cole7 in complex with im7

PDB Compounds: (A:) colicin e7 immunity protein

SCOPe Domain Sequences for d2jb0a_:

Sequence; same for both SEQRES and ATOM records:

>d2jb0a_ a.28.2.1 (A:) ImmE7 protein (Im7) {Escherichia coli [TaxId: 562]}
lknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdnrd
dspegivkeikewraangkpgfkqg

Timeline for d2jb0a_:

• d2jb0a_ first appeared in SCOP 1.73, called d2jb0a1
  
• d2jb0a_ appears in SCOPe 2.05
  
• d2jb0a_ appears in SCOPe 2.07
  
• d2jb0a_ appears in the current release, SCOPe 2.08