SCOP 1.75: Domain d2jb0a1: 2jb0 A:3-87

Lineage for d2jb0a1 (2jb0 A:3-87)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family)

5. Family a.28.2.1: Colicin E immunity proteins [47346] (3 proteins)

6. Protein ImmE7 protein (Im7) [47347] (1 species)

7. Species Escherichia coli [TaxId:562] [47348] (10 PDB entries)

8. Domain d2jb0a1: 2jb0 A:3-87 [138246]
   Other proteins in same PDB: d2jb0b1
   automatically matched to d1mz8a_
   complexed with zn; mutant

Details for d2jb0a1

PDB Entry: 2jb0, 1.91 Å

PDB Description: crystal structure of the mutant h573a of the nuclease domain of cole7 in complex with im7

PDB Compounds: (A:) colicin e7 immunity protein

SCOP Domain Sequences for d2jb0a1:

Sequence; same for both SEQRES and ATOM records:

>d2jb0a1 a.28.2.1 (A:3-87) ImmE7 protein (Im7) {Escherichia coli [TaxId: 562]}
lknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdnrd
dspegivkeikewraangkpgfkqg

Timeline for d2jb0a1:

• d2jb0a1 first appeared in SCOP 1.73
  
• d2jb0a1 is called d2jb0a_ in SCOPe 2.01
  
• d2jb0a1 appears in the current release, SCOPe 2.08, called d2jb0a_