![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family) ![]() |
![]() | Family a.28.2.1: Colicin E immunity proteins [47346] (3 proteins) |
![]() | Protein ImmE7 protein (Im7) [47347] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [47348] (10 PDB entries) |
![]() | Domain d2jb0a1: 2jb0 A:3-87 [138246] Other proteins in same PDB: d2jb0b1 automatically matched to d1mz8a_ complexed with zn; mutant |
PDB Entry: 2jb0 (more details), 1.91 Å
SCOP Domain Sequences for d2jb0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jb0a1 a.28.2.1 (A:3-87) ImmE7 protein (Im7) {Escherichia coli [TaxId: 562]} lknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdnrd dspegivkeikewraangkpgfkqg
Timeline for d2jb0a1: