Lineage for d2jb0a1 (2jb0 A:3-87)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 639734Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 639785Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family) (S)
  5. 639786Family a.28.2.1: Colicin E immunity proteins [47346] (3 proteins)
  6. 639787Protein ImmE7 protein (Im7) [47347] (1 species)
  7. 639788Species Escherichia coli [TaxId:562] [47348] (10 PDB entries)
  8. 639795Domain d2jb0a1: 2jb0 A:3-87 [138246]
    Other proteins in same PDB: d2jb0b1
    automatically matched to d1mz8a_
    complexed with zn; mutant

Details for d2jb0a1

PDB Entry: 2jb0 (more details), 1.91 Å

PDB Description: crystal structure of the mutant h573a of the nuclease domain of cole7 in complex with im7
PDB Compounds: (A:) colicin e7 immunity protein

SCOP Domain Sequences for d2jb0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jb0a1 a.28.2.1 (A:3-87) ImmE7 protein (Im7) {Escherichia coli [TaxId: 562]}
lknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdnrd
dspegivkeikewraangkpgfkqg

SCOP Domain Coordinates for d2jb0a1:

Click to download the PDB-style file with coordinates for d2jb0a1.
(The format of our PDB-style files is described here.)

Timeline for d2jb0a1: