Lineage for d2java1 (2jav A:3-271)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1931371Protein Serine/threonine-protein kinase Nek2 [143893] (1 species)
    NIMA subfamily (NimA-related protein kinase 2)
  7. 1931372Species Human (Homo sapiens) [TaxId:9606] [143894] (1 PDB entry)
    Uniprot P51955 3-271
  8. 1931373Domain d2java1: 2jav A:3-271 [138243]
    complexed with 5z5

Details for d2java1

PDB Entry: 2jav (more details), 2.2 Å

PDB Description: human kinase with pyrrole-indolinone ligand
PDB Compounds: (A:) serine/threonine-protein kinase nek2

SCOPe Domain Sequences for d2java1:

Sequence, based on SEQRES records: (download)

>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]}
sraedyevlytigtgsygrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllrel
khpnivryydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtqltl
alkechrrsdgghtvlhrdlkpanvfldgkqnvklgdfglarilnhdtsfakafvgtpyy
mspeqmnrmsyneksdiwslgcllyelcalmppftafsqkelagkiregkfrripyrysd
elneiitrmlnlkdyhrpsveeilenpli

Sequence, based on observed residues (ATOM records): (download)

>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]}
sraedyevlytigtgsygrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllrel
khpnivryydriidtlyivmeyceggdlasvitkgtkerqyldeefvlrvmtqltlalke
chrrsdlkpanvfldgkqnvklgdfglarilgtpyymspeqmnrmsyneksdiwslgcll
yelcalmppftafsqkelagkiregkfrripyrysdelneiitrmlnlkdyhrpsveeil
enpli

SCOPe Domain Coordinates for d2java1:

Click to download the PDB-style file with coordinates for d2java1.
(The format of our PDB-style files is described here.)

Timeline for d2java1: