![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) ![]() |
![]() | Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (5 proteins) |
![]() | Protein Beta-glucosidase A [51528] (7 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [89475] (22 PDB entries) |
![]() | Domain d2jalb1: 2jal B:3-445 [138242] automatically matched to d1od0b_ complexed with act, ca, yll |
PDB Entry: 2jal (more details), 1.9 Å
SCOP Domain Sequences for d2jalb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jalb1 c.1.8.4 (B:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrfm hqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkf dpdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvse dgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdys tqkrivkdsgywysnvvknngle
Timeline for d2jalb1: