Lineage for d2jala_ (2jal A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2083072Protein automated matches [190245] (11 species)
    not a true protein
  7. 2083101Species Thermotoga maritima [TaxId:2336] [187021] (20 PDB entries)
  8. 2083132Domain d2jala_: 2jal A: [138241]
    automated match to d1od0b_
    complexed with act, ca, yll

Details for d2jala_

PDB Entry: 2jal (more details), 1.9 Å

PDB Description: beta-glucosidase from thermotoga maritima in complex with cyclophellitol
PDB Compounds: (A:) beta-glucosidase a

SCOPe Domain Sequences for d2jala_:

Sequence, based on SEQRES records: (download)

>d2jala_ c.1.8.4 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw
dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap
gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrfm
hqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkf
dpdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvse
dgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdys
tqkrivkdsgywysnvvknngle

Sequence, based on observed residues (ATOM records): (download)

>d2jala_ c.1.8.4 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw
dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap
gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepaseravrfmhqfnn
yplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkfdpdak
vsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvsedgrvhdq
nridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdystqkrivk
dsgywysnvvknngle

SCOPe Domain Coordinates for d2jala_:

Click to download the PDB-style file with coordinates for d2jala_.
(The format of our PDB-style files is described here.)

Timeline for d2jala_: