Lineage for d2jaab1 (2jaa B:128-320)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651720Fold a.250: IpaD-like [140692] (1 superfamily)
    6 helices; bundle, up-and-down; can be divided into two four-helical bundles sharing two helices (3 and 6), which are twice longer than the rest
  4. 651721Superfamily a.250.1: IpaD-like [140693] (1 family) (S)
  5. 651722Family a.250.1.1: IpaD-like [140694] (2 proteins)
    Pfam PF06511
  6. 651723Protein Invasin IpaD [140695] (1 species)
  7. 651724Species Shigella flexneri [TaxId:623] [140696] (3 PDB entries)
  8. 651730Domain d2jaab1: 2jaa B:128-320 [138239]
    automatically matched to 2JAA A:128-320

Details for d2jaab1

PDB Entry: 2jaa (more details), 3.1 Å

PDB Description: semet substituted shigella flexneri ipad
PDB Compounds: (B:) invasin ipad

SCOP Domain Sequences for d2jaab1:

Sequence, based on SEQRES records: (download)

>d2jaab1 a.250.1.1 (B:128-320) Invasin IpaD {Shigella flexneri [TaxId: 623]}
mishrelwakiansindineqylkvyehavssytqmyqdfsavlsslagwispggndgns
vklqvnslkkaleelkekykdkplypanntvsqeqankwltelggtigkvsqknggyvvs
inmtpidnmlksldnlggngevvldnakyqawnagfsaedetmknnlqtlvqkysnansi
fdnlvkvlsstis

Sequence, based on observed residues (ATOM records): (download)

>d2jaab1 a.250.1.1 (B:128-320) Invasin IpaD {Shigella flexneri [TaxId: 623]}
mishrelwakiansindineqylkvyehavssytqmyqdfsavlsslagwispvklqvns
lkkaleelkekykdkplypanntvsqeqankwltelggtigkvsqknggyvvsinmtpid
nmlksldnlnakyqawnagfsaedetmknnlqtlvqkysnansifdnlvkvlsstis

SCOP Domain Coordinates for d2jaab1:

Click to download the PDB-style file with coordinates for d2jaab1.
(The format of our PDB-style files is described here.)

Timeline for d2jaab1: