Lineage for d2jaaa1 (2jaa A:128-320)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738288Fold a.250: IpaD-like [140692] (1 superfamily)
    6 helices; bundle, up-and-down; can be divided into two four-helical bundles sharing two helices (3 and 6), which are twice longer than the rest
  4. 2738289Superfamily a.250.1: IpaD-like [140693] (2 families) (S)
  5. 2738290Family a.250.1.1: IpaD-like [140694] (3 proteins)
    Pfam PF06511
  6. 2738291Protein Invasin IpaD [140695] (1 species)
  7. 2738292Species Shigella flexneri [TaxId:623] [140696] (3 PDB entries)
    Uniprot P18013 128-320! Uniprot P18013 144-314! Uniprot P18013 39-322
  8. 2738296Domain d2jaaa1: 2jaa A:128-320 [138238]
    Other proteins in same PDB: d2jaab_
    truncated, lacks two N-terminal helices

Details for d2jaaa1

PDB Entry: 2jaa (more details), 3.1 Å

PDB Description: semet substituted shigella flexneri ipad
PDB Compounds: (A:) invasin ipad

SCOPe Domain Sequences for d2jaaa1:

Sequence, based on SEQRES records: (download)

>d2jaaa1 a.250.1.1 (A:128-320) Invasin IpaD {Shigella flexneri [TaxId: 623]}
mishrelwakiansindineqylkvyehavssytqmyqdfsavlsslagwispggndgns
vklqvnslkkaleelkekykdkplypanntvsqeqankwltelggtigkvsqknggyvvs
inmtpidnmlksldnlggngevvldnakyqawnagfsaedetmknnlqtlvqkysnansi
fdnlvkvlsstis

Sequence, based on observed residues (ATOM records): (download)

>d2jaaa1 a.250.1.1 (A:128-320) Invasin IpaD {Shigella flexneri [TaxId: 623]}
mishrelwakiansindineqylkvyehavssytqmyqdfsavlsslagwvnslkkalee
lkekykdkplypanntvsqeqankwltelggtigkvsqknggyvvsinmtpidnmlksln
akyqawnagfsaedetmknnlqtlvqkysnansifdnlvkvlsstis

SCOPe Domain Coordinates for d2jaaa1:

Click to download the PDB-style file with coordinates for d2jaaa1.
(The format of our PDB-style files is described here.)

Timeline for d2jaaa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2jaab_