Lineage for d2ja8k1 (2ja8 K:1-114)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1209032Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1209136Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) (S)
    form homo and heterodimers
  5. 1209217Family d.74.3.2: RBP11/RpoL [64311] (3 proteins)
  6. 1209224Protein RPB11 [64312] (1 species)
  7. 1209225Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (23 PDB entries)
    Uniprot P38902; part of multichain biological unit
  8. 1209244Domain d2ja8k1: 2ja8 K:1-114 [138236]
    Other proteins in same PDB: d2ja8a1, d2ja8b1, d2ja8c1, d2ja8c2, d2ja8d1, d2ja8e1, d2ja8e2, d2ja8f1, d2ja8g1, d2ja8g2, d2ja8h1, d2ja8i1, d2ja8i2, d2ja8j1, d2ja8l1
    automatically matched to d1i3qk_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja8k1

PDB Entry: 2ja8 (more details), 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex d
PDB Compounds: (K:) DNA-directed RNA polymerase II 13.6 kDa polypeptide

SCOPe Domain Sequences for d2ja8k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ja8k1 d.74.3.2 (K:1-114) RPB11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

SCOPe Domain Coordinates for d2ja8k1:

Click to download the PDB-style file with coordinates for d2ja8k1.
(The format of our PDB-style files is described here.)

Timeline for d2ja8k1: