Lineage for d2ja8j1 (2ja8 J:1-65)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1480666Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
    automatically mapped to Pfam PF01194
  5. 1480667Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins)
    Zn-binding site is near the N-terminus
  6. 1480668Protein RNA polymerase subunit RPB10 [46926] (3 species)
  7. 1480669Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (28 PDB entries)
    Uniprot P22139; part of multichain biological unit
  8. 1480694Domain d2ja8j1: 2ja8 J:1-65 [138235]
    Other proteins in same PDB: d2ja8a1, d2ja8b1, d2ja8c1, d2ja8c2, d2ja8d1, d2ja8e1, d2ja8e2, d2ja8f1, d2ja8g1, d2ja8g2, d2ja8h1, d2ja8i1, d2ja8i2, d2ja8k1, d2ja8l1
    automatically matched to d1i3qj_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja8j1

PDB Entry: 2ja8 (more details), 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex d
PDB Compounds: (J:) DNA-directed RNA polymerases I/II/III subunit 10

SCOPe Domain Sequences for d2ja8j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ja8j1 a.4.11.1 (J:1-65) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

SCOPe Domain Coordinates for d2ja8j1:

Click to download the PDB-style file with coordinates for d2ja8j1.
(The format of our PDB-style files is described here.)

Timeline for d2ja8j1: