| Class g: Small proteins [56992] (90 folds) |
| Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families) ![]() |
| Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins) |
| Protein RBP9 subunit of RNA polymerase II [57787] (2 species) contains two differently decorated domains of this fold |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries) Uniprot P27999; part of multichain biological unit |
| Domain d2ja8i2: 2ja8 I:50-117 [138234] Other proteins in same PDB: d2ja8a1, d2ja8b1, d2ja8c1, d2ja8c2, d2ja8d1, d2ja8e1, d2ja8e2, d2ja8f1, d2ja8g1, d2ja8g2, d2ja8h1, d2ja8j1, d2ja8k1, d2ja8l1 automatically matched to d1i3qi2 protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 2ja8 (more details), 3.8 Å
SCOPe Domain Sequences for d2ja8i2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ja8i2 g.41.3.1 (I:50-117) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi
ftsdqknk
Timeline for d2ja8i2: