Lineage for d2ja8c1 (2ja8 C:3-37,C:173-268)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2200525Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2200656Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2200657Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)
  6. 2200730Protein RPB3 [64315] (2 species)
  7. 2200731Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (24 PDB entries)
    Uniprot P16370; part of multichain biological unit
  8. 2200752Domain d2ja8c1: 2ja8 C:3-37,C:173-268 [138224]
    Other proteins in same PDB: d2ja8a1, d2ja8b1, d2ja8c2, d2ja8d1, d2ja8e1, d2ja8e2, d2ja8f1, d2ja8g1, d2ja8g2, d2ja8h1, d2ja8i1, d2ja8i2, d2ja8j1, d2ja8k1, d2ja8l1
    automatically matched to d1i3qc1
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja8c1

PDB Entry: 2ja8 (more details), 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex d
PDB Compounds: (C:) DNA-directed RNA polymerase II 45kda polypeptide

SCOPe Domain Sequences for d2ja8c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ja8c1 d.74.3.1 (C:3-37,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eegpqvkireaskdnvdfilsnvdlamanslrrvmXaaaiefeydpwnklkhtdywyeqd
sakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlqkkva
sillaltqmdqd

SCOPe Domain Coordinates for d2ja8c1:

Click to download the PDB-style file with coordinates for d2ja8c1.
(The format of our PDB-style files is described here.)

Timeline for d2ja8c1: