SCOPe 2.08: Domain d2ja7u2: 2ja7 U:50-117

Lineage for d2ja7u2 (2ja7 U:50-117)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families)

5. Family g.41.3.1: Transcriptional factor domain [57784] (6 proteins)

6. Protein RBP9 subunit of RNA polymerase II [57787] (3 species)
   contains two differently decorated domains of this fold

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)
   Uniprot P27999; part of multichain biological unit

8. Domain d2ja7u2: 2ja7 U:50-117 [138218]
   Other proteins in same PDB: d2ja7a1, d2ja7b1, d2ja7c1, d2ja7c2, d2ja7d1, d2ja7e1, d2ja7e2, d2ja7f1, d2ja7g1, d2ja7g2, d2ja7h1, d2ja7j1, d2ja7k1, d2ja7l1, d2ja7m1, d2ja7n1, d2ja7o1, d2ja7o2, d2ja7p1, d2ja7q1, d2ja7q2, d2ja7r1, d2ja7s1, d2ja7s2, d2ja7t1, d2ja7v1, d2ja7w1, d2ja7x1
   automatically matched to d1i3qi2
   protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja7u2

PDB Entry: 2ja7, 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex c

PDB Compounds: (U:) DNA-directed RNA polymerase II subunit 9

SCOPe Domain Sequences for d2ja7u2:

Sequence; same for both SEQRES and ATOM records:

>d2ja7u2 g.41.3.1 (U:50-117) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi
ftsdqknk

Timeline for d2ja7u2:

• d2ja7u2 first appeared in SCOP 1.73
  
• d2ja7u2 appears in SCOPe 2.07