Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.230: Dodecin subunit-like [88797] (6 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
Superfamily d.230.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88798] (1 family) automatically mapped to Pfam PF03876 |
Family d.230.1.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88799] (1 protein) |
Protein N-terminal, heterodimerisation domain of RBP7 (RpoE) [88800] (3 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117777] (6 PDB entries) Uniprot P34087 |
Domain d2ja7s2: 2ja7 S:1-80 [138215] Other proteins in same PDB: d2ja7a1, d2ja7b1, d2ja7c1, d2ja7c2, d2ja7d1, d2ja7e1, d2ja7e2, d2ja7f1, d2ja7g1, d2ja7h1, d2ja7i1, d2ja7i2, d2ja7j1, d2ja7k1, d2ja7l1, d2ja7m1, d2ja7n1, d2ja7o1, d2ja7o2, d2ja7p1, d2ja7q1, d2ja7q2, d2ja7r1, d2ja7s1, d2ja7t1, d2ja7u1, d2ja7u2, d2ja7v1, d2ja7w1, d2ja7x1 automatically matched to d1y14b2 protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 2ja7 (more details), 3.8 Å
SCOPe Domain Sequences for d2ja7s2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ja7s2 d.230.1.1 (S:1-80) N-terminal, heterodimerisation domain of RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mffikdlslnitlhpsffgprmkqylktklleevegsctgkfgyilcvldydnidiqrgr ilptdgsaefnvkyravvfk
Timeline for d2ja7s2:
View in 3D Domains from other chains: (mouse over for more information) d2ja7a1, d2ja7b1, d2ja7c1, d2ja7c2, d2ja7d1, d2ja7e1, d2ja7e2, d2ja7f1, d2ja7g1, d2ja7g2, d2ja7h1, d2ja7i1, d2ja7i2, d2ja7j1, d2ja7k1, d2ja7l1, d2ja7m1, d2ja7n1, d2ja7o1, d2ja7o2, d2ja7p1, d2ja7q1, d2ja7q2, d2ja7r1, d2ja7t1, d2ja7u1, d2ja7u2, d2ja7v1, d2ja7w1, d2ja7x1 |