Lineage for d2ja7s1 (2ja7 S:81-171)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1541496Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1541517Protein C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) [88670] (3 species)
  7. 1541518Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117195] (6 PDB entries)
    Uniprot P34087
  8. 1541522Domain d2ja7s1: 2ja7 S:81-171 [138214]
    Other proteins in same PDB: d2ja7a1, d2ja7b1, d2ja7c1, d2ja7c2, d2ja7d1, d2ja7e1, d2ja7e2, d2ja7f1, d2ja7g2, d2ja7h1, d2ja7i1, d2ja7i2, d2ja7j1, d2ja7k1, d2ja7l1, d2ja7m1, d2ja7n1, d2ja7o1, d2ja7o2, d2ja7p1, d2ja7q1, d2ja7q2, d2ja7r1, d2ja7s2, d2ja7t1, d2ja7u1, d2ja7u2, d2ja7v1, d2ja7w1, d2ja7x1
    automatically matched to d1y14b1
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja7s1

PDB Entry: 2ja7 (more details), 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex c
PDB Compounds: (S:) DNA-directed RNA polymerase II 19kda polypeptide

SCOPe Domain Sequences for d2ja7s1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ja7s1 b.40.4.5 (S:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdltfnagsnppsyqssedvitik
srirvkiegcisqvssihaigsikedylgai

SCOPe Domain Coordinates for d2ja7s1:

Click to download the PDB-style file with coordinates for d2ja7s1.
(The format of our PDB-style files is described here.)

Timeline for d2ja7s1: