Lineage for d2ja7o1 (2ja7 O:3-37,O:173-268)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1656918Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1657041Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 1657042Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)
  6. 1657113Protein RPB3 [64315] (2 species)
  7. 1657114Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (24 PDB entries)
    Uniprot P16370; part of multichain biological unit
  8. 1657130Domain d2ja7o1: 2ja7 O:3-37,O:173-268 [138208]
    Other proteins in same PDB: d2ja7a1, d2ja7b1, d2ja7c2, d2ja7d1, d2ja7e1, d2ja7e2, d2ja7f1, d2ja7g1, d2ja7g2, d2ja7h1, d2ja7i1, d2ja7i2, d2ja7j1, d2ja7k1, d2ja7l1, d2ja7m1, d2ja7n1, d2ja7o2, d2ja7p1, d2ja7q1, d2ja7q2, d2ja7r1, d2ja7s1, d2ja7s2, d2ja7t1, d2ja7u1, d2ja7u2, d2ja7v1, d2ja7w1, d2ja7x1
    automatically matched to d1i3qc1
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja7o1

PDB Entry: 2ja7 (more details), 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex c
PDB Compounds: (O:) DNA-directed RNA polymerase II 45kda polypeptide

SCOPe Domain Sequences for d2ja7o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ja7o1 d.74.3.1 (O:3-37,O:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eegpqvkireaskdnvdfilsnvdlamanslrrvmXaaaiefeydpwnklkhtdywyeqd
sakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlqkkva
sillaltqmdqd

SCOPe Domain Coordinates for d2ja7o1:

Click to download the PDB-style file with coordinates for d2ja7o1.
(The format of our PDB-style files is described here.)

Timeline for d2ja7o1: