Lineage for d2ja7a1 (2ja7 A:2-1450)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574250Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2574251Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2574346Family e.29.1.2: RNA-polymerase beta-prime [64490] (4 protein domains)
  6. 2574347Protein RBP1 [64486] (2 species)
  7. 2574348Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64487] (24 PDB entries)
    Uniprot P04050; part of multichain biological unit
  8. 2574367Domain d2ja7a1: 2ja7 A:2-1450 [138190]
    Other proteins in same PDB: d2ja7b1, d2ja7c1, d2ja7c2, d2ja7d1, d2ja7e1, d2ja7e2, d2ja7f1, d2ja7g1, d2ja7g2, d2ja7h1, d2ja7i1, d2ja7i2, d2ja7j1, d2ja7k1, d2ja7l1, d2ja7n1, d2ja7o1, d2ja7o2, d2ja7p1, d2ja7q1, d2ja7q2, d2ja7r1, d2ja7s1, d2ja7s2, d2ja7t1, d2ja7u1, d2ja7u2, d2ja7v1, d2ja7w1, d2ja7x1
    automatically matched to d1i50a_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja7a1

PDB Entry: 2ja7 (more details), 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex c
PDB Compounds: (A:) DNA-directed RNA polymerase II largest subunit

SCOPe Domain Sequences for d2ja7a1:

Sequence, based on SEQRES records: (download)

>d2ja7a1 e.29.1.2 (A:2-1450) RBP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vgqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsi
drnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnel
mrqalaikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglkl
vgswkkdratgdadepelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpv
ppppvrpsisfnesqrgeddltfkladilkanisletlehngaphhaieeaesllqfhva
tymdndiagqpqalqksgrpvksirarlkgkegrirgnlmgkrvdfsartvisgdpnlel
dqvgvpksiaktltypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskra
gdiqlqygwkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspynad
fdgdemnlhvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtfi
eldqvlnmlywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllspk
dngmliidgqiifgvvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhng
fstgigdtiadgptmreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvrf
lneardkagrlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfvd
rtlphfskddyspeskgfvensylrgltpqefffhamggreglidtavktaetgyiqrrl
vkaledimvhydnttrnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvdl
lntdhtldpsllesgseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvnir
riiqnaqqtfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccl
lrsrlatrrvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtl
ntfhfagvaskkvtsgvprlkeilnvaknmktpsltvylepghaadqeqaklirsaieht
tlksvtiaseiyydpdprstvipedeeiiqlhfslldeeaeqsfdqqspwllrleldraa
mndkdltmgqvgerikqtfkndlfviwsedndekliircrvvrpksldaeteaeedhmlk
kientmlenitlrgveniervvmmkydrkvpsptgeyvkepewvletdgvnlsevmtvpg
idptriytnsfidimevlgieagraalykevynviasdgsyvnyrhmallvdvmttqggl
tsvtrhgfnrsntgalmrcsfeetveilfeagasaelddcrgvsenvilgqmapigtgaf
dvmideesl

Sequence, based on observed residues (ATOM records): (download)

>d2ja7a1 e.29.1.2 (A:2-1450) RBP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vgqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsi
drnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnel
mrqalaikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglkl
vgswkkdrdepelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpvppppv
rpsisfnesqrgeddltfkladilkanisletlehngaphhaieeaesllqfhvatymdn
diagqpqalqksgrpvksirarlkgkegrirgnlmgkrvdfsartvisgdpnleldqvgv
pksiaktltypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskragdiql
qygwkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspynadfdgde
mnlhvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtfieldqv
lnmlywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllspkdngml
iidgqiifgvvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhngfstgi
gdtiadgptmreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvrflnear
dkagrlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfvdrtlph
fskddyspeskgfvensylrgltpqefffhamggreglidtavktaetgyiqrrlvkale
dimvhydnttrnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvdllntdh
tldpsllesgseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvnirriiqn
aqqtfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccllrsrl
atrrvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtlkkvts
gvprlkeilnvaknmktpsltvylepghaadqeqaklirsaiehttlksvtiaseiyydp
dprstvipedeeiiqlhfslqqspwllrleldraamndkdltmgqvgerikqtfkndlfv
iwsedndekliircrvvrpaeedhmlkkientmlenitlrgveniervvmmkydrkvpsp
tgeyvkepewvletdgvnlsevmtvpgidptriytnsfidimevlgieagraalykevyn
viasdgsyvnyrhmallvdvmttqggltsvtrhgfnrsntgalmrcsfeetveilfeaga
saelddcrgvsenvilgqmapigtgafdvmideesl

SCOPe Domain Coordinates for d2ja7a1:

Click to download the PDB-style file with coordinates for d2ja7a1.
(The format of our PDB-style files is described here.)

Timeline for d2ja7a1: