Lineage for d2ja6k1 (2ja6 K:1-114)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564740Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2564876Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2564986Family d.74.3.2: RBP11/RpoL [64311] (4 proteins)
  6. 2564996Protein RPB11 [64312] (2 species)
  7. 2564997Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (23 PDB entries)
    Uniprot P38902; part of multichain biological unit
  8. 2565018Domain d2ja6k1: 2ja6 K:1-114 [138188]
    Other proteins in same PDB: d2ja6a1, d2ja6b1, d2ja6c1, d2ja6c2, d2ja6d1, d2ja6e1, d2ja6e2, d2ja6f1, d2ja6g1, d2ja6g2, d2ja6h1, d2ja6i1, d2ja6i2, d2ja6j1, d2ja6l1
    automatically matched to d1i3qk_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja6k1

PDB Entry: 2ja6 (more details), 4 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex b
PDB Compounds: (K:) DNA-directed RNA polymerase II 13.6 kDa polypeptide

SCOPe Domain Sequences for d2ja6k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ja6k1 d.74.3.2 (K:1-114) RPB11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

SCOPe Domain Coordinates for d2ja6k1:

Click to download the PDB-style file with coordinates for d2ja6k1.
(The format of our PDB-style files is described here.)

Timeline for d2ja6k1: