Lineage for d2ja6h1 (2ja6 H:2-146)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2059387Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2060352Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein)
    duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10
    automatically mapped to Pfam PF03870
  6. 2060353Protein RNA polymerase subunit RBP8 [50322] (2 species)
  7. 2060354Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (35 PDB entries)
    Uniprot P20436
  8. 2060387Domain d2ja6h1: 2ja6 H:2-146 [138184]
    Other proteins in same PDB: d2ja6a1, d2ja6b1, d2ja6c1, d2ja6c2, d2ja6d1, d2ja6e1, d2ja6e2, d2ja6f1, d2ja6g1, d2ja6g2, d2ja6i1, d2ja6i2, d2ja6j1, d2ja6k1, d2ja6l1
    automatically matched to d1a1d__
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja6h1

PDB Entry: 2ja6 (more details), 4 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex b
PDB Compounds: (H:) DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide

SCOPe Domain Sequences for d2ja6h1:

Sequence, based on SEQRES records: (download)

>d2ja6h1 b.40.4.8 (H:2-146) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
slnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggl
lmrlegnyrnlnnlkqenayllirr

Sequence, based on observed residues (ATOM records): (download)

>d2ja6h1 b.40.4.8 (H:2-146) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
slnltrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrn
lnnlkqenayllirr

SCOPe Domain Coordinates for d2ja6h1:

Click to download the PDB-style file with coordinates for d2ja6h1.
(The format of our PDB-style files is described here.)

Timeline for d2ja6h1: