Lineage for d2ja6f1 (2ja6 F:72-155)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017141Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 2017142Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 2017191Family a.143.1.2: RPB6 [55294] (2 proteins)
  6. 2017192Protein RPB6 [55295] (3 species)
    essential subunit of RNA polymerases I, II and III
  7. 2017193Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (30 PDB entries)
    Uniprot P20435; part of multichain biological unit
  8. 2017222Domain d2ja6f1: 2ja6 F:72-155 [138181]
    Other proteins in same PDB: d2ja6a1, d2ja6b1, d2ja6c1, d2ja6c2, d2ja6d1, d2ja6e1, d2ja6e2, d2ja6g1, d2ja6g2, d2ja6h1, d2ja6i1, d2ja6i2, d2ja6j1, d2ja6k1, d2ja6l1
    automatically matched to d1i3qf_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja6f1

PDB Entry: 2ja6 (more details), 4 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex b
PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

SCOPe Domain Sequences for d2ja6f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ja6f1 a.143.1.2 (F:72-155) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

SCOPe Domain Coordinates for d2ja6f1:

Click to download the PDB-style file with coordinates for d2ja6f1.
(The format of our PDB-style files is described here.)

Timeline for d2ja6f1: