SCOP 1.73: Domain d2ja6f1: 2ja6 F:72-155

Lineage for d2ja6f1 (2ja6 F:72-155)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
   core: 2 helices and adjacent loops

4. Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families)
   the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits

5. Family a.143.1.2: RPB6 [55294] (1 protein)

6. Protein RPB6 [55295] (2 species)
   essential subunit of RNA polymerases I, II and III

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (24 PDB entries)

8. Domain d2ja6f1: 2ja6 F:72-155 [138181]
   Other proteins in same PDB: d2ja6a1, d2ja6b1, d2ja6c1, d2ja6c2, d2ja6d1, d2ja6e1, d2ja6e2, d2ja6g1, d2ja6g2, d2ja6h1, d2ja6i1, d2ja6i2, d2ja6j1, d2ja6k1, d2ja6l1
   automatically matched to d1i3qf_
   complexed with bru, mg, tt, zn

Details for d2ja6f1

PDB Entry: 2ja6, 4 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex b

PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

SCOP Domain Sequences for d2ja6f1:

Sequence; same for both SEQRES and ATOM records:

>d2ja6f1 a.143.1.2 (F:72-155) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

Timeline for d2ja6f1:

• d2ja6f1 is new in SCOP 1.73
  
• d2ja6f1 appears in SCOP 1.75
  
• d2ja6f1 appears in the current release, SCOPe 2.08