Lineage for d2ja6e2 (2ja6 E:144-215)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201058Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
    core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta
  4. 2201059Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) (S)
    automatically mapped to Pfam PF01191
  5. 2201060Family d.78.1.1: RPB5 [55288] (2 proteins)
  6. 2201061Protein Eukaryotic RPB5 C-terminal domain [55292] (2 species)
  7. 2201062Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (26 PDB entries)
    Uniprot P20434; part of multichain biological unit
  8. 2201087Domain d2ja6e2: 2ja6 E:144-215 [138180]
    Other proteins in same PDB: d2ja6a1, d2ja6b1, d2ja6c1, d2ja6c2, d2ja6d1, d2ja6e1, d2ja6f1, d2ja6g1, d2ja6g2, d2ja6h1, d2ja6i1, d2ja6i2, d2ja6j1, d2ja6k1, d2ja6l1
    automatically matched to d1dzfa2
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja6e2

PDB Entry: 2ja6 (more details), 4 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex b
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOPe Domain Sequences for d2ja6e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ja6e2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

SCOPe Domain Coordinates for d2ja6e2:

Click to download the PDB-style file with coordinates for d2ja6e2.
(The format of our PDB-style files is described here.)

Timeline for d2ja6e2: