SCOPe 2.03: Domain d2ja6e1: 2ja6 E:2-143

Lineage for d2ja6e1 (2ja6 E:2-143)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family)

5. Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (1 protein)

6. Protein Eukaryotic RPB5 N-terminal domain [53038] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (26 PDB entries)
   Uniprot P20434; part of multichain biological unit

8. Domain d2ja6e1: 2ja6 E:2-143 [138179]
   Other proteins in same PDB: d2ja6a1, d2ja6b1, d2ja6c1, d2ja6c2, d2ja6d1, d2ja6e2, d2ja6f1, d2ja6g1, d2ja6g2, d2ja6h1, d2ja6i1, d2ja6i2, d2ja6j1, d2ja6k1, d2ja6l1
   automatically matched to d1i3qe1
   protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja6e1

PDB Entry: 2ja6, 4 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex b

PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOPe Domain Sequences for d2ja6e1:

Sequence; same for both SEQRES and ATOM records:

>d2ja6e1 c.52.3.1 (E:2-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfq
anpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsam
klvpsippatietfneaalvvn

Timeline for d2ja6e1:

• d2ja6e1 first appeared in SCOP 1.73
  
• d2ja6e1 appears in SCOPe 2.02
  
• d2ja6e1 appears in SCOPe 2.04
  
• d2ja6e1 appears in the current release, SCOPe 2.08