Lineage for d2ja6c1 (2ja6 C:3-37,C:173-268)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1913462Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1913588Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 1913589Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)
  6. 1913660Protein RPB3 [64315] (2 species)
  7. 1913661Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (24 PDB entries)
    Uniprot P16370; part of multichain biological unit
  8. 1913683Domain d2ja6c1: 2ja6 C:3-37,C:173-268 [138176]
    Other proteins in same PDB: d2ja6a1, d2ja6b1, d2ja6c2, d2ja6d1, d2ja6e1, d2ja6e2, d2ja6f1, d2ja6g1, d2ja6g2, d2ja6h1, d2ja6i1, d2ja6i2, d2ja6j1, d2ja6k1, d2ja6l1
    automatically matched to d1i3qc1
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja6c1

PDB Entry: 2ja6 (more details), 4 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex b
PDB Compounds: (C:) DNA-directed RNA polymerase II 45kda polypeptide

SCOPe Domain Sequences for d2ja6c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ja6c1 d.74.3.1 (C:3-37,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eegpqvkireaskdnvdfilsnvdlamanslrrvmXaaaiefeydpwnklkhtdywyeqd
sakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlqkkva
sillaltqmdqd

SCOPe Domain Coordinates for d2ja6c1:

Click to download the PDB-style file with coordinates for d2ja6c1.
(The format of our PDB-style files is described here.)

Timeline for d2ja6c1: