Lineage for d2ja6b1 (2ja6 B:20-1224)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 885463Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 885464Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 885465Family e.29.1.1: RNA-polymerase beta [64485] (2 proteins)
  6. 885466Protein RBP2 [64491] (1 species)
  7. 885467Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64492] (29 PDB entries)
    Uniprot P08518; part of multichain biological unit
  8. 885494Domain d2ja6b1: 2ja6 B:20-1224 [138175]
    Other proteins in same PDB: d2ja6a1, d2ja6c1, d2ja6c2, d2ja6d1, d2ja6e1, d2ja6e2, d2ja6f1, d2ja6g1, d2ja6g2, d2ja6h1, d2ja6i1, d2ja6i2, d2ja6j1, d2ja6k1, d2ja6l1
    automatically matched to d1i50b_
    complexed with bru, mg, tt, zn

Details for d2ja6b1

PDB Entry: 2ja6 (more details), 4 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex b
PDB Compounds: (B:) DNA-directed RNA polymerase II 140 kDa polypeptide

SCOP Domain Sequences for d2ja6b1:

Sequence, based on SEQRES records: (download)

>d2ja6b1 e.29.1.1 (B:20-1224) RBP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstlileqlaqhtt
esdnisrkyeisfgkiyvtkpmvnesdgvthalypqearlrnltyssglfvdvkkrtyea
idvpgrelkyeliaeeseddsesgkvfigrlpimlrskncylseatesdlyklkecpfdm
ggyfiingsekvliaqersagnivqvfkkaapspishvaeirsalekgsrfistlqvkly
gregssartikatlpyikqdipiviifralgiipdgeilehicydvndwqmlemlkpcve
dgfviqdretaldfigrrgtalgikkekriqyakdilqkeflphitqlegfesrkafflg
yminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdifrymqrtveea
hdfnmklainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstlshlrrtn
tpigrdgklakprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitfls
ewgmepledyvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdi
rekelkiftdagrvyrplfiveddeslghkelkvrkghiaklmateyqdieggfedveey
twssllneglveyidaeeeesiliamqpedlepaeaneendldvdpakrirvshhattft
hceihpsmilgvaasiipfpdhnqsprntyqsamgkqamgvfltnynvrmdtmanilyyp
qkplgttrameylkfrelpagqnaivaiacysgynqedsmimnqssidrglfrslffrsy
mdqekkygmsitetfekpqrtntlrmkhgtydkldddgliapgvrvsgedviigkttpis
pdeeelgqrtayhskrdastplrstengivdqvlvttnqdglkfvkvrvrttkipqigdk
fasrhgqkgtigityrredmpftaegivpdliinphaipsrmtvahliecllskvaalsg
negdaspftditvegiskllrehgyqsrgfevmynghtgkklmaqiffgptyyqrlrhmv
ddkiharargpmqvltrqpvegrsrdgglrfgemerdcmiahgaasflkerlmeasdafr
vhicgicglmtviaklnhnqfeckgcdnkidiyqihipyaakllfqelmamnitprlytd
rsrdf

Sequence, based on observed residues (ATOM records): (download)

>d2ja6b1 e.29.1.1 (B:20-1224) RBP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstliisfgkiyvt
kpmvnesdgvthalypqearlrnltyssglfvdvkkvfigrlpimlrskncylseatesd
lyklkecpfdmggyfiingsekvliaqersagnivqvfkkaapspishvaeirsalekgs
rfistlqvklygregssartikatlpyikqdipiviifralgiipdgeilehicydvndw
qmlemlkpcvedgfviqdretaldfigrrgtalgikkekriqyakdilqkeflphitqle
gfesrkafflgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdi
frymqrtvelainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstlshlr
rtntpikprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitflsewgm
epledyvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdireke
lkiftdagrvyrplfiveddeslghkelkvrkghiaklmateyqdeytwssllneglvey
idaeeeesiliamqpedlepaeadvdpakrirvshhattfthceihpsmilgvaasiipf
pdhnqsprntyqsamgkqamgvfltnynvrmdtmanilyypqkplgttrameylkfrelp
agqnaivaiacysgynqedsmimnqssidrglfrslffrsymdqekkygmsitetfekpq
rtntlrmkhgtydkldddgliapgvrvsgedviigkttpisskrdastplrstengivdq
vlvttnqdglkfvkvrvrttkipqigdkfasrhgqkgtigityrredmpftaegivpdli
inphaipsrmtvahliecllskvaalsgnegdaspftditvegiskllrehgyqsrgfev
mynghtgkklmaqiffgptyyqrlrhmvddkiharargpmqvltrqpvegrsrdgglrfg
emerdcmiahgaasflkerlmeasdafrvhicgicglmtviaklnhnqfeckgcdnkidi
yqihipyaakllfqelmamnitprlytdrsrdf

SCOP Domain Coordinates for d2ja6b1:

Click to download the PDB-style file with coordinates for d2ja6b1.
(The format of our PDB-style files is described here.)

Timeline for d2ja6b1: