Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) |
Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (1 protein) Zn-binding site is near the N-terminus |
Protein RNA polymerase subunit RPB10 [46926] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (29 PDB entries) Uniprot P22139; part of multichain biological unit |
Domain d2ja5j1: 2ja5 J:1-65 [138171] Other proteins in same PDB: d2ja5a1, d2ja5b1, d2ja5c1, d2ja5c2, d2ja5d1, d2ja5e1, d2ja5e2, d2ja5f1, d2ja5g1, d2ja5g2, d2ja5h1, d2ja5i1, d2ja5i2, d2ja5k1, d2ja5l1 automatically matched to d1i3qj_ complexed with bru, mg, zn |
PDB Entry: 2ja5 (more details), 3.8 Å
SCOP Domain Sequences for d2ja5j1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ja5j1 a.4.11.1 (J:1-65) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf lrynp
Timeline for d2ja5j1: