Lineage for d2ja5i2 (2ja5 I:50-117)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 750747Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families) (S)
  5. 750748Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins)
  6. 750749Protein RBP9 subunit of RNA polymerase II [57787] (2 species)
    contains two differently decorated domains of this fold
  7. 750752Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)
  8. 750792Domain d2ja5i2: 2ja5 I:50-117 [138170]
    Other proteins in same PDB: d2ja5a1, d2ja5b1, d2ja5c1, d2ja5c2, d2ja5d1, d2ja5e1, d2ja5e2, d2ja5f1, d2ja5g1, d2ja5g2, d2ja5h1, d2ja5j1, d2ja5k1, d2ja5l1
    automatically matched to d1i3qi2
    complexed with bru, mg, zn

Details for d2ja5i2

PDB Entry: 2ja5 (more details), 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex a
PDB Compounds: (I:) DNA-directed RNA polymerase II subunit 9

SCOP Domain Sequences for d2ja5i2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ja5i2 g.41.3.1 (I:50-117) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi
ftsdqknk

SCOP Domain Coordinates for d2ja5i2:

Click to download the PDB-style file with coordinates for d2ja5i2.
(The format of our PDB-style files is described here.)

Timeline for d2ja5i2: