Lineage for d2ja5g2 (2ja5 G:1-80)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1686869Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 1686870Superfamily d.230.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88798] (1 family) (S)
    automatically mapped to Pfam PF03876
  5. 1686871Family d.230.1.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88799] (1 protein)
  6. 1686872Protein N-terminal, heterodimerisation domain of RBP7 (RpoE) [88800] (3 species)
  7. 1686873Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117777] (6 PDB entries)
    Uniprot P34087
  8. 1686878Domain d2ja5g2: 2ja5 G:1-80 [138167]
    Other proteins in same PDB: d2ja5a1, d2ja5b1, d2ja5c1, d2ja5c2, d2ja5d1, d2ja5e1, d2ja5e2, d2ja5f1, d2ja5g1, d2ja5h1, d2ja5i1, d2ja5i2, d2ja5j1, d2ja5k1, d2ja5l1
    automatically matched to d1y14b2
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja5g2

PDB Entry: 2ja5 (more details), 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex a
PDB Compounds: (G:) DNA-directed RNA polymerase II 19kda polypeptide

SCOPe Domain Sequences for d2ja5g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ja5g2 d.230.1.1 (G:1-80) N-terminal, heterodimerisation domain of RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mffikdlslnitlhpsffgprmkqylktklleevegsctgkfgyilcvldydnidiqrgr
ilptdgsaefnvkyravvfk

SCOPe Domain Coordinates for d2ja5g2:

Click to download the PDB-style file with coordinates for d2ja5g2.
(The format of our PDB-style files is described here.)

Timeline for d2ja5g2: