SCOP 1.73: Domain d2ja5g2: 2ja5 G:1-80

Lineage for d2ja5g2 (2ja5 G:1-80)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.230: Dodecin subunit-like [88797] (5 superfamilies)
   beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132

4. Superfamily d.230.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88798] (1 family)

5. Family d.230.1.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88799] (1 protein)

6. Protein N-terminal, heterodimerisation domain of RBP7 (RpoE) [88800] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117777] (6 PDB entries)

8. Domain d2ja5g2: 2ja5 G:1-80 [138167]
   Other proteins in same PDB: d2ja5a1, d2ja5b1, d2ja5c1, d2ja5c2, d2ja5d1, d2ja5e1, d2ja5e2, d2ja5f1, d2ja5g1, d2ja5h1, d2ja5i1, d2ja5i2, d2ja5j1, d2ja5k1, d2ja5l1
   automatically matched to d1y14b2
   complexed with bru, mg, zn

Details for d2ja5g2

PDB Entry: 2ja5, 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex a

PDB Compounds: (G:) DNA-directed RNA polymerase II 19kda polypeptide

SCOP Domain Sequences for d2ja5g2:

Sequence; same for both SEQRES and ATOM records:

>d2ja5g2 d.230.1.1 (G:1-80) N-terminal, heterodimerisation domain of RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mffikdlslnitlhpsffgprmkqylktklleevegsctgkfgyilcvldydnidiqrgr
ilptdgsaefnvkyravvfk

Timeline for d2ja5g2:

• d2ja5g2 is new in SCOP 1.73
  
• d2ja5g2 appears in SCOP 1.75
  
• d2ja5g2 appears in the current release, SCOPe 2.07