Class b: All beta proteins [48724] (176 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
Protein C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) [88670] (3 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117195] (6 PDB entries) Uniprot P34087 |
Domain d2ja5g1: 2ja5 G:81-171 [138166] Other proteins in same PDB: d2ja5a1, d2ja5b1, d2ja5c1, d2ja5c2, d2ja5d1, d2ja5e1, d2ja5e2, d2ja5f1, d2ja5g2, d2ja5h1, d2ja5i1, d2ja5i2, d2ja5j1, d2ja5k1, d2ja5l1 automatically matched to d1y14b1 protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 2ja5 (more details), 3.8 Å
SCOPe Domain Sequences for d2ja5g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ja5g1 b.40.4.5 (G:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} pfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdltfnagsnppsyqssedvitik srirvkiegcisqvssihaigsikedylgai
Timeline for d2ja5g1: