Lineage for d2ja5g1 (2ja5 G:81-171)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668013Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) (S)
  5. 668307Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
    barrel, closed; n=5, S=8
  6. 668328Protein C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) [88670] (3 species)
  7. 668332Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117195] (6 PDB entries)
  8. 668338Domain d2ja5g1: 2ja5 G:81-171 [138166]
    Other proteins in same PDB: d2ja5a1, d2ja5b1, d2ja5c1, d2ja5c2, d2ja5d1, d2ja5e1, d2ja5e2, d2ja5f1, d2ja5g2, d2ja5h1, d2ja5i1, d2ja5i2, d2ja5j1, d2ja5k1, d2ja5l1
    automatically matched to d1y14b1
    complexed with bru, mg, zn

Details for d2ja5g1

PDB Entry: 2ja5 (more details), 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex a
PDB Compounds: (G:) DNA-directed RNA polymerase II 19kda polypeptide

SCOP Domain Sequences for d2ja5g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ja5g1 b.40.4.5 (G:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdltfnagsnppsyqssedvitik
srirvkiegcisqvssihaigsikedylgai

SCOP Domain Coordinates for d2ja5g1:

Click to download the PDB-style file with coordinates for d2ja5g1.
(The format of our PDB-style files is described here.)

Timeline for d2ja5g1: