Class a: All alpha proteins [46456] (285 folds) |
Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
Family a.143.1.2: RPB6 [55294] (2 proteins) |
Protein RPB6 [55295] (3 species) essential subunit of RNA polymerases I, II and III |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (30 PDB entries) Uniprot P20435; part of multichain biological unit |
Domain d2ja5f1: 2ja5 F:72-155 [138165] Other proteins in same PDB: d2ja5a1, d2ja5b1, d2ja5c1, d2ja5c2, d2ja5d1, d2ja5e1, d2ja5e2, d2ja5g1, d2ja5g2, d2ja5h1, d2ja5i1, d2ja5i2, d2ja5j1, d2ja5k1, d2ja5l1 automatically matched to d1i3qf_ protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 2ja5 (more details), 3.8 Å
SCOPe Domain Sequences for d2ja5f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ja5f1 a.143.1.2 (F:72-155) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip lvirrylpdgsfedwsveelivdl
Timeline for d2ja5f1: