Lineage for d2ja5e2 (2ja5 E:144-215)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1032033Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
    core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta
  4. 1032034Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (1 family) (S)
  5. 1032035Family d.78.1.1: RPB5 [55288] (2 proteins)
  6. 1032036Protein Eukaryotic RPB5 C-terminal domain [55292] (1 species)
  7. 1032037Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (25 PDB entries)
    Uniprot P20434; part of multichain biological unit
  8. 1032058Domain d2ja5e2: 2ja5 E:144-215 [138164]
    Other proteins in same PDB: d2ja5a1, d2ja5b1, d2ja5c1, d2ja5c2, d2ja5d1, d2ja5e1, d2ja5f1, d2ja5g1, d2ja5g2, d2ja5h1, d2ja5i1, d2ja5i2, d2ja5j1, d2ja5k1, d2ja5l1
    automatically matched to d1dzfa2
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja5e2

PDB Entry: 2ja5 (more details), 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex a
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOPe Domain Sequences for d2ja5e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ja5e2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

SCOPe Domain Coordinates for d2ja5e2:

Click to download the PDB-style file with coordinates for d2ja5e2.
(The format of our PDB-style files is described here.)

Timeline for d2ja5e2: