SCOP 1.73: Domain d2j9uc1: 2j9u C:148-241

Lineage for d2j9uc1 (2j9u C:148-241)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.28: VPS28 C-terminal domain-like [140427] (1 family)

5. Family a.24.28.1: VPS28 C-terminal domain-like [140428] (1 protein)
   C-terminal part of Pfam PF03997

6. Protein Vacuolar protein sorting-associated protein 28, VPS28 [140429] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140430] (3 PDB entries)

8. Domain d2j9uc1: 2j9u C:148-241 [138156]
   automatically matched to 2G3K A:148-241
   complexed with zn

Details for d2j9uc1

PDB Entry: 2j9u, 2 Å

PDB Description: 2 angstrom x-ray structure of the yeast escrt-i vps28 c-terminus in complex with the nzf-n domain from escrt-ii

PDB Compounds: (C:) vacuolar protein sorting-associated protein 28

SCOP Domain Sequences for d2j9uc1:

Sequence; same for both SEQRES and ATOM records:

>d2j9uc1 a.24.28.1 (C:148-241) Vacuolar protein sorting-associated protein 28, VPS28 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrsklidwiv
rinklsigdtltetqirellfdlelayksfyall

Timeline for d2j9uc1:

• d2j9uc1 is new in SCOP 1.73
  
• d2j9uc1 appears in SCOP 1.75
  
• d2j9uc1 appears in the current release, SCOPe 2.08, called d2j9uc_