![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.28: VPS28 C-terminal domain-like [140427] (2 families) ![]() |
![]() | Family a.24.28.1: VPS28 C-terminal domain-like [140428] (2 proteins) C-terminal part of Pfam PF03997 |
![]() | Protein automated matches [190730] (1 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187898] (2 PDB entries) |
![]() | Domain d2j9ua_: 2j9u A: [138155] Other proteins in same PDB: d2j9ub1, d2j9ud_ automated match to d2g3ka1 complexed with zn |
PDB Entry: 2j9u (more details), 2 Å
SCOPe Domain Sequences for d2j9ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j9ua_ a.24.28.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} fnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrsklidwiv rinklsigdtltetqirellfdlelayksfyall
Timeline for d2j9ua_: