Lineage for d2j9tb1 (2j9t B:35-301)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651720Fold a.250: IpaD-like [140692] (1 superfamily)
    6 helices; bundle, up-and-down; can be divided into two four-helical bundles sharing two helices (3 and 6), which are twice longer than the rest
  4. 651721Superfamily a.250.1: IpaD-like [140693] (1 family) (S)
  5. 651722Family a.250.1.1: IpaD-like [140694] (2 proteins)
    Pfam PF06511
  6. 651731Protein Putative membrane antigen BipD [140697] (1 species)
  7. 651732Species Burkholderia pseudomallei [TaxId:28450] [140698] (3 PDB entries)
  8. 651737Domain d2j9tb1: 2j9t B:35-301 [138154]
    automatically matched to 2J9T A:35-301
    complexed with bo3, flc

Details for d2j9tb1

PDB Entry: 2j9t (more details), 2.7 Å

PDB Description: BipD of Burkholderia Pseudomallei
PDB Compounds: (B:) membrane antigen

SCOP Domain Sequences for d2j9tb1:

Sequence, based on SEQRES records: (download)

>d2j9tb1 a.250.1.1 (B:35-301) Putative membrane antigen BipD {Burkholderia pseudomallei [TaxId: 28450]}
mtdddlraagvdrrvpeqklgaaidefaslrlpdridgrfvdgrranltvfddarvavrg
haraqrnllerletellggtldtagdeggiqpdpilqglvdvigqgksdidayativegl
tkyfqsvadvmsklqdyisakddknmkidggkikaliqqvidhlptmqlpkgadiarwrk
elgdavsisdsgvvtinpdklikmrdslppdgtvwdtaryqawntafsgqkdniqndvqt
lvekyshqnsnfdnlvkvlsgaistlt

Sequence, based on observed residues (ATOM records): (download)

>d2j9tb1 a.250.1.1 (B:35-301) Putative membrane antigen BipD {Burkholderia pseudomallei [TaxId: 28450]}
mtdddlraagvdrrvpeqklgaaidefaslrlpdridgrfvdgrranltvfddarvavrg
haraqrnllerletelldpilqglvdvigqgksdidayativegltkyfqsvadvmsklq
dyisakddknmkidggkikaliqqvidhlptmqlpkgadiarwrkelgdavsisdsgvvt
inpdklikmrdslppdgtvwdtaryqawntafsgqkdniqndvqtlvekyshqnsnfdnl
vkvlsgaistlt

SCOP Domain Coordinates for d2j9tb1:

Click to download the PDB-style file with coordinates for d2j9tb1.
(The format of our PDB-style files is described here.)

Timeline for d2j9tb1: