Lineage for d2j9ta1 (2j9t A:35-301)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016066Fold a.250: IpaD-like [140692] (1 superfamily)
    6 helices; bundle, up-and-down; can be divided into two four-helical bundles sharing two helices (3 and 6), which are twice longer than the rest
  4. 2016067Superfamily a.250.1: IpaD-like [140693] (2 families) (S)
  5. 2016068Family a.250.1.1: IpaD-like [140694] (3 protein domains)
    Pfam PF06511
  6. 2016075Protein Putative membrane antigen BipD [140697] (1 species)
  7. 2016076Species Burkholderia pseudomallei [TaxId:28450] [140698] (5 PDB entries)
    Uniprot Q63K37 35-301
  8. 2016083Domain d2j9ta1: 2j9t A:35-301 [138153]
    complexed with bo3, flc

Details for d2j9ta1

PDB Entry: 2j9t (more details), 2.7 Å

PDB Description: BipD of Burkholderia Pseudomallei
PDB Compounds: (A:) membrane antigen

SCOPe Domain Sequences for d2j9ta1:

Sequence, based on SEQRES records: (download)

>d2j9ta1 a.250.1.1 (A:35-301) Putative membrane antigen BipD {Burkholderia pseudomallei [TaxId: 28450]}
mtdddlraagvdrrvpeqklgaaidefaslrlpdridgrfvdgrranltvfddarvavrg
haraqrnllerletellggtldtagdeggiqpdpilqglvdvigqgksdidayativegl
tkyfqsvadvmsklqdyisakddknmkidggkikaliqqvidhlptmqlpkgadiarwrk
elgdavsisdsgvvtinpdklikmrdslppdgtvwdtaryqawntafsgqkdniqndvqt
lvekyshqnsnfdnlvkvlsgaistlt

Sequence, based on observed residues (ATOM records): (download)

>d2j9ta1 a.250.1.1 (A:35-301) Putative membrane antigen BipD {Burkholderia pseudomallei [TaxId: 28450]}
mtdddlraagvdrrvpeqklgaaidefaslrlpdridgrfvdgrranltvfddarvavrg
haraqrnllerletelldpilqglvdvigqgksdidayativegltkyfqsvadvmsklq
dyisakddknmkidggkikaliqqvidhlptmqlpkgadiarwrkelgdavsisdsgvvt
inpdklikmrdslppdgtvwdtaryqawntafsgqkdniqndvqtlvekyshqnsnfdnl
vkvlsgaistlt

SCOPe Domain Coordinates for d2j9ta1:

Click to download the PDB-style file with coordinates for d2j9ta1.
(The format of our PDB-style files is described here.)

Timeline for d2j9ta1: