Lineage for d2j9aa1 (2j9a A:160-485)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2142305Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2142493Family c.56.5.3: Leucine aminopeptidase, C-terminal domain [53201] (2 proteins)
    automatically mapped to Pfam PF00883
  6. 2142517Protein automated matches [254524] (1 species)
    not a true protein
  7. 2142518Species Cow (Bos taurus) [TaxId:9913] [255155] (2 PDB entries)
  8. 2142519Domain d2j9aa1: 2j9a A:160-485 [138149]
    Other proteins in same PDB: d2j9aa2
    automated match to d1lama1
    complexed with ahy, cl, dms, mpd, zn

Details for d2j9aa1

PDB Entry: 2j9a (more details), 1.73 Å

PDB Description: bllap in complex with microginin fr1
PDB Compounds: (A:) cytosol aminopeptidase

SCOPe Domain Sequences for d2j9aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j9aa1 c.56.5.3 (A:160-485) automated matches {Cow (Bos taurus) [TaxId: 9913]}
fasgqnlarrlmetpanemtptkfaeiveenlksasiktdvfirpkswieeqemgsflsv
akgseeppvfleihykgspnasepplvfvgkgitfdsggisikaaanmdlmradmggaat
icsaivsaakldlpinivglaplcenmpsgkankpgdvvrarngktiqvdntdaegrlil
adalcyahtfnpkviinaatltgamdialgsgatgvftnsswlwnklfeasietgdrvwr
mplfehytrqvidcqladvnnigkyrsagactaaaflkefvthpkwahldiagvmtnkde
vpylrkgmagrptrtlieflfrfsqe

SCOPe Domain Coordinates for d2j9aa1:

Click to download the PDB-style file with coordinates for d2j9aa1.
(The format of our PDB-style files is described here.)

Timeline for d2j9aa1: